PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G14030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 69aa    MW: 7981.36 Da    PI: 10.6691
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G14030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.58.2e-102360140
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     r rW+ eE++++++a  ++G + Wk+I   +  ++t+ q+
     OB05G14030.1 23 RERWSGEEHDRFLHALMLFGRD-WKRIEGFVA-TKTATQV 60
                     78******************77.********9.9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.8E-111262IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-92260IPR006447Myb domain, plants
PfamPF002491.8E-72360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-62360IPR009057Homeodomain-like
CDDcd001672.12E-52560No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MAAMAAPVLG KKTRKPYTIT RPRERWSGEE HDRFLHALML FGRDWKRIEG FVATKTATQV  60
PIDFIHPCV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664992.16e-36PREDICTED: protein REVEILLE 6-like
SwissprotP929731e-18CCA1_ARATH; Protein CCA1
TrEMBLJ3KUZ41e-43J3KUZ4_ORYBR; Uncharacterized protein
TrEMBLJ3M4795e-46J3M479_ORYBR; Uncharacterized protein
STRINGOB05G14030.11e-45(Oryza brachyantha)
STRINGOB0093G10070.13e-43(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.17e-20circadian clock associated 1